PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0287s0010.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family NF-YA
Protein Properties Length: 343aa    MW: 37067.7 Da    PI: 8.029
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0287s0010.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.39.1e-32177232258
            CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                           p+YVNaKQy++Il+RRq+Rak+e ekkl +k rkpylheSRh+hA+rR+Rg+gGrF
  Kalax.0287s0010.2.p 177 PPVYVNAKQYHGILRRRQSRAKAELEKKL-IKVRKPYLHESRHQHAIRRARGTGGRF 232
                          59***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.1E-35174235IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.814175235IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.7E-27178232IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.8E-24178200IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860180200IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.8E-24209232IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MVYGNMPTKP ESVNRPSIGL HGNPSPAVYS EPWWCSTGYN PAQSVVATVN AGHQPSGSLE  60
SNTVQSFSNS GPNEDDEDND VSKKSQQDAA RQQERSLPGD GNNIMSVALT SATDNCITQQ  120
PQLELVGHSV ACALGPFQDP YYGGLMSAYG PQPMIYPHPL GPQHARMPLP HEVAQEPPVY  180
VNAKQYHGIL RRRQSRAKAE LEKKLIKVRK PYLHESRHQH AIRRARGTGG RFAKKTDAEN  240
GGPAATQSVS SSGSELMPSD SAETWNSPMG RDVAKGSQAQ MQTEQHKQAA TDQNGGYGNG  300
SAFQPASYHS GNRNEENDCS SQQWGSISGN NKATSQRRFA IQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-18176232258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006470622.11e-100PREDICTED: nuclear transcription factor Y subunit A-1
RefseqXP_006470621.11e-100PREDICTED: nuclear transcription factor Y subunit A-1
RefseqXP_006470620.11e-100PREDICTED: nuclear transcription factor Y subunit A-1
RefseqXP_006470619.11e-100PREDICTED: nuclear transcription factor Y subunit A-1
RefseqXP_006446128.11e-100hypothetical protein CICLE_v10015808mg
RefseqXP_006446127.11e-100hypothetical protein CICLE_v10015808mg
RefseqXP_006446126.11e-100hypothetical protein CICLE_v10015808mg
RefseqXP_006446125.11e-100hypothetical protein CICLE_v10015808mg
TrEMBLA0A067F5721e-100A0A067F572_CITSI; Uncharacterized protein
TrEMBLV4U5J81e-100V4U5J8_9R
STRINGGLYMA08G45030.11e-89(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.32e-60nuclear factor Y, subunit A1